McDonnell Genome Institute

Washington University

CircRNA

chr2|24741783|24742186|+|NCOA1|ENST00000288599.9

Cancer

Type of Peptide

BRCA-HER2-enriched

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9487

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

LALESILR

Amino Acids from 5' Exons

PPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSFGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLANRNSMVSRGMTGNIGGQFGTGINPQMQQNVFQYPGA,HPMLKCWHNVSGNCTVNSTDRGSYSSKEPCLGSKALGTTSLPHLDYQFKWGTPVFLRVLHSNSPIHQTMVQIQEPHLLLPARFHNQQILKHPWPTATAWAEAQETEDSLALESILRCSRMSSSIQEQ,TPECSNVGTTSAGTVQSTAPTEAANTAAKSHAYEAAKLWEQPPSLIWTTSSNGEPPSSSGCSTAIPLSTKLWYKSRNPTCFYQPVFTTSSKSSILGQPQQHGEQRHDRKHRRTVWHWNQSSDAAECLPVSRS

Amino Acids from 3' Exons

PPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSFGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLANRNSMVSRGMTGNIGGQFGTGINPQMQQNVFQYPGA,HPMLKCWHNVSGNCTVNSTDRGSYSSKEPCLGSKALGTTSLPHLDYQFKWGTPVFLRVLHSNSPIHQTMVQIQEPHLLLPARFHNQQILKHPWPTATAWAEAQETEDSLALESILRCSRMSSSIQEQ,TPECSNVGTTSAGTVQSTAPTEAANTAAKSHAYEAAKLWEQPPSLIWTTSSNGEPPSSSGCSTAIPLSTKLWYKSRNPTCFYQPVFTTSSKSSILGQPQQHGEQRHDRKHRRTVWHWNQSSDAAECLPVSRS