McDonnell Genome Institute

Washington University

CircRNA

chr2|24693251|24697798|+|NCOA1|ENST00000288599.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9369

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

5

Peptide

QLFQEDFQSCLICIAR

Amino Acids from 5' Exons

ISSHVFVLHGDYLGLQLLRVNPLPSKILQ,FPVMSDLYCTAITSASSYYGCRILYDQARYY,FQSCLICIARRLPRPPAITGVESFMTKQDTT

Amino Acids from 3' Exons

VKSSLLILVPELLAELVGKIGSAFMLFSNLRAENHLMPDSCSKK,NHLYYFPESCWQNWLGRFSEEVHLCFFPTSGQRTILCQTAVPR,KIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQE