McDonnell Genome Institute

Washington University

CircRNA

chr2|24301153|24312375|-|ITSN2|ENST00000355123.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9932

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

2

Peptide

LIPLMELCLHIRK

Amino Acids from 5' Exons

RRKANFHWNSAFISENARRGASEEIT,GGKQIDSINGTLPSYQKMQEEEPQKKLP,EESKLIPLMELCLHIRKCKKRSLRRNYQ

Amino Acids from 3' Exons

GFIRPKQGWEDGSARVLHSYETHQTEASRPTVACGSPSYYEATPYVFSINFCSF,ALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFSPLISARF,LYQTTRMGRWISKSSPLNSSNSFKANSCLWFSLLLSNPLCFLHFLLVL