McDonnell Genome Institute

Washington University

CircRNA

chr2|24295663|24308756|-|ITSN2|ENST00000355123.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9944

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

14

Peptide

NFSSTSSTASLSGNSPK

Amino Acids from 5' Exons

NGKHQQISGRLQDVRLKKQTQKTELEVLDKQCDLEIMEIKQLQQELQ,MANISRSQADFRMSDSKSKLKRLSWKFWISSVTWKLWKSSNFNRNF,WQTSADLRQTSGCPTQKANSKDAGSSGAVLGNYGNQATSTGTS

Amino Acids from 3' Exons

LNFLDCFTLRELTQDWDLRVGSSSAYKIKISAKIYSQKYEWISL,STSSTASLSGNSPKTGTSEWAVPQPTRLKYRQKFNTLDKSMSGYLS,QLPRLLHSQGTHPRLGPQSGQFLSLQDNIGKNLILLTKVVDISQ