McDonnell Genome Institute

Washington University

CircRNA

chr2|241602969|241606473|-|THAP4|ENST00000402136.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9253

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

VAFVSAQNTEPPK

Amino Acids from 5' Exons

VQLLPPGHAQADAQRVWLHSPQARHQQGGLCQRPEH,FNSFHPDTRKPMHRECGFIRLKPDTNKVAFVSAQNT,STPSTRTRASRCTESVASFASSPTPTRWPLSAPRTQ

Amino Acids from 3' Exons

SPPRTQWWSHCPGCWAPGCRTHLEPGPTPHCSPSSTWRRFTSPTWASPCTS,APQDEPSGGATVLDAGHLAVGPTWSRDLPHTAALPVPGGGSHLPRGPAHAELL,PPKMNPVVEPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNF