top of page

McDonnell Genome Institute

Washington University

CircRNA

chr2|241403827|241475987|+|FARP2|ENST00000264042.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9168

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

13

Peptide

DLVGIENLIAPGRPK

Amino Acids from 5' Exons

PKCDGQVLLTQVWKRLNLVECDYFGMEFQNTQSYW,LNAMARYYHKCGSVTWNVTTSGWSFKILSPT,MRWPGITDTSVEAFKPGRMLLRDGVSKYSVLL

Amino Acids from 3' Exons

TPKPSQRPPHYSTFSSGWRTCRSRSCSGTWWARTSLLLA,RPESHHRGDHHTTAHSHPAGEPAEANGAAAGPGGHREPHCSWQ,ALKAITEVTTTLQHILIRLENLQKLTELQRDLVGIENLIAPGR

bottom of page