McDonnell Genome Institute

Washington University

CircRNA

chr2|241255050|241264605|-|HDLBP|ENST00000310931.8

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

40

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

17

Peptide

AACLESAQEPAGAWGNK

Amino Acids from 5' Exons

ANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPK,PIASPSPLSPPLPGFTVSSLARKGRTWPKSLSRCQ,QLHRLLCRRPFLASPFHHWQERAEPGQNHSADAK

Amino Acids from 3' Exons

LPLIQKRRATLQPTRMPSLHFLRKLLAWKVPRNPLEPGGTRSDPSRLLSSL,CHSKFRRGERPSNLQGCLPSTSESCLPGKCPGTRWSLGEQDPTHQGFCHHS,ATLNSEEESDPPTYKDAFPPLPEKAACLESAQEPAGAWGNKIRPIKASVITQ