McDonnell Genome Institute

Washington University

CircRNA

chr2|241252956|241256806|-|HDLBP|ENST00000310931.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9804

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

9

Peptide

AVPTASATVAIPK

Amino Acids from 5' Exons

INRMDYVEINIDHKFHRHLIGKSGAN,LTGWTMWRSTSTTSSTGTSLGRAVPT,PDGLCGDQHRPQVPQAPHWEERCQ

Amino Acids from 3' Exons

ASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQ,PQQLLPFPKNTIALLLAKMERNCKTWSKLQPKSRSHAQMTPAIRSRSLAPKRASRKLAMKSYSSLPS,LSNCCHSQRTPSLCYWQKWRETARLGAKNCNQNPDPTPRPQQSDQDHWHQRGHRESSPSLTHLCRA