McDonnell Genome Institute

Washington University

CircRNA

chr2|241238648|241242678|-|HDLBP|ENST00000310931.8

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

13

Peptide

TQANIAEVEVSIPAK

Amino Acids from 5' Exons

EAQVTLECAIPQKFHRSVMGPKGSRIQQITRDFSVQIKFPDREENA,KLRHNVLYPRNSIDLSWAPKVPESSRLLGISVFKLNSQTERRTQ,SSGDIRMCYTPEIPSICHGPQRFQNPADYSGFQCSNIPRQRGER

Amino Acids from 3' Exons

ANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEK,PTPRRSPSLPSCTTPSLAPRAVSAPSWRSAAGSTFTFPWKVQEATPLLSGALPRMWRRPRSSSCIWRRR,QHSRGRGLHPCQAAQLPHWHQGPSDPLHHGGVRRGPHSLSRGRFRKRHRCYQGPFLGCGEGQEAAPASGGGE