McDonnell Genome Institute

Washington University

CircRNA

chr2|237376771|237381499|-|COL6A3|ENST00000295550.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9901

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

23

5

Peptide

IGDLHPQIVNLLKSVHNGAPAPVIEVNK

Amino Acids from 5' Exons

RASETFCSSLTAQPILWASSLLSVTFSTRLSMSSMSQRGPELRWLSTAMMSRWSPVLMSTRVSLRSILRERSRRAKPSTWATRWTMHRGTFLSLLAAGSRMECFSSWCCWSQEGHLTVWMGQQVTSRVGLCLSSSKPRTQTLLSSRSCCLQRLSWLQSRFPRLEIFIHRISNQCTTEHQHQ,EQARHSVPLRLSQSCGPVPCCPLSLQDYRAQCEARGDPNCGGSVQRCQGGVPFAPEADPESCEENEDQDGQSPQPGLRAGLCTEVHFCEVCWQPDRGWSASVPGAAGRRKVIPCGWASKPEAEWGCAFHLPSQERRPCVRADRAVSSVYPGCRVASQDWRSSSTDSESLKISAQRSTST,SKRDILFLFDGSANLVGQFPVVRDFLYKIIDELNVKPEGTRIAVAQYSDDVKVESRFDEHQSKPEILNLVKRMKIKTGKALNLGYALDYAQRYIFVKSAGSRIEDGVLQFLVLLVAGRSSDRVDGPASNLKQSGVVPFIFQAKNADPAELEQIVLSPAFILAAESLPKIGDLHPQIVNLLKSVHNGAPAP

Amino Acids from 3' Exons

SLKSTRETSSWWMAHLHWDWPTSMPSETSLLKSSRGWKSDRILSRWQWPSMQTLGLNFISIPIQQKGKSPLCGKSPWTARPCTRALLTLFVTTYSRVQPATGLPRGFLSFWCSQVVSPMKSASLPRSREAAWPLPLGTRVPIRLSWKRSLSTPPWCSSQLSSEPPHCKACCLACWHLSGPSLEPLK,HSQQERHSLPGGWLICTGTGQLQCHPRLHCSHPEAGNRTGSYPGGSGPVCRHCEAILFQYPSNKKGSHNRCAENEAPGRLGPVHGLCSRLCSQPIHEFSRLPGCRGDSAFGADHRWVPRNQPACPGAEEKQHNGLCHWEQGCRSGAGRDRFRLLPGVHPSVPSRPIARHAAWLAGTSQDPLWNP,IEVNKRDIVFLVDGSSALGLANFNAIRDFIAKVIQRLEIGQDLIQVAVAQYADTVRPEFYFNTHPTKREVITAVRKMKPLDGSALYTGSALDFVRNNLFTSSAGYRAAEGIPKLLVLITGGKSLDEISQPAQELKRSSIMAFAIGNKGADQAELEEIAFDSSLVFIPAEFRAAPLQGMLPGLLAPLRTLSGTPE