McDonnell Genome Institute

Washington University

CircRNA

chr2|237363252|237377344|-|COL6A3|ENST00000295550.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

75

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

LNLLDLDYELAEQLR

Amino Acids from 5' Exons

ESVPSWWALNEWSTWSGCIWSLGEGLCMTGPGLTCWTWIMNRSS,SPCLDPGGPTSGQLGAANASGVWARVYVQAPEALAGLGLTSGAA,VRALILVGLERVVNLERLMHLEFGRGFMYDRPLRLNLLDLDYELAEQL

Amino Acids from 3' Exons

RASETFCSSLTAQPILWASSLLSVTFSTRLSMSSMSQRGPELRWLSTAMMSRWSPVLMSTRVSLRSILRERSRRAKPSTWATRWTMHRGTFLSLLAAGSRMECFSSWCCWSQEGHLTVWMGQQVTSRVGLCLSSSKPRTQTLLSSRSCCLQRLSWLQSRFPRLEIFIHRISNQCTTEHQHQ,EQARHSVPLRLSQSCGPVPCCPLSLQDYRAQCEARGDPNCGGSVQRCQGGVPFAPEADPESCEENEDQDGQSPQPGLRAGLCTEVHFCEVCWQPDRGWSASVPGAAGRRKVIPCGWASKPEAEWGCAFHLPSQERRPCVRADRAVSSVYPGCRVASQDWRSSSTDSESLKISAQRSTST,SKRDILFLFDGSANLVGQFPVVRDFLYKIIDELNVKPEGTRIAVAQYSDDVKVESRFDEHQSKPEILNLVKRMKIKTGKALNLGYALDYAQRYIFVKSAGSRIEDGVLQFLVLLVAGRSSDRVDGPASNLKQSGVVPFIFQAKNADPAELEQIVLSPAFILAAESLPKIGDLHPQIVNLLKSVHNGAPAP