McDonnell Genome Institute

Washington University

CircRNA

chr2|233438216|233441995|+|DGKD|ENST00000264057.6

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9989

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

8

Peptide

STASTFINR

Amino Acids from 5' Exons

GSGRPAVLLLAQAHCWSSSIQKVGTTRVSSSEDSNSYTPPRSSTSTEAHTS,VLEGQLSSFLHKPTVGLRQFKKWGQPGCEVPQKIQTATKPRPGLRPHERRPTPR,FWKASCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLMNGGPHL

Amino Acids from 3' Exons

LTVIPEVHIPDSGLWRGWKCWLGPLRNRQPQPST,LRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQ,YGYSRSLTHSGFWFVAGMEVLAGSSPKSTASTFIN