McDonnell Genome Institute

Washington University

CircRNA

chr2|233204125|233204717|+|INPP5D|ENST00000359570.9

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9854

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

6

Peptide

LPCRPSDLGK

Amino Acids from 5' Exons

AQPGEERRGHAASGGPAADEARDVEPPVWVPEFLPACSQEGPGIPQNAAEGTPALPGTRHLVAQHRAHQSPGGSRRGARQAGARAPAALLHVLILCRGQGGRRGQEPREAQDPGQLPGPGAGQEAHQAFQIGNQPADPAHPDAAAAAASQEPGGAAPPALQGPRLPRQHRAPASRQAPAGGGATRASRQDCHA,PSDLGKNAGDTLPQEDLPLTKPEMFENPLYGSLSSFPKPAPRKDQESPKMPRKEPPPCPEPGILSPSIVLTKAQEADRGEGPGKQVPAPRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQTPPTPTPRPPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEGPPGPLGRTAMQ,PVTWGRTQGTRCLRRTCRRSPRCLRTPCMGPVPSLSLLPGRTRNPPKCRGRNPRPARNPASCRPASCSPKPRRLIAARGPASRCPRPGCAPSRAHPLPRAGRPAGTRAKGSPRPRSAPRPRCRPRGPSSLPDRKSTSRPRPPRRRGRRCQSRARRCCTSSTPRAATTATTPSSRITASTGRRRGHQGLAGLPC

Amino Acids from 3' Exons

AQPGEERRGHAASGGPAADEARDVEPPVWVPEFLPACSQEGPGIPQNAAEGTPALPGTRHLVAQHRAHQSPGGSRRGARQAGARAPAALLHVLILCRGQGGRRGQEPREAQDPGQLPGPGAGQEAHQAFQIGNQPADPAHPDAAAAAASQEPGGAAPPALQGPRLPRQHRAPASRQAPAGGGATRASRQDCHA,PSDLGKNAGDTLPQEDLPLTKPEMFENPLYGSLSSFPKPAPRKDQESPKMPRKEPPPCPEPGILSPSIVLTKAQEADRGEGPGKQVPAPRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQTPPTPTPRPPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEGPPGPLGRTAMQ,PVTWGRTQGTRCLRRTCRRSPRCLRTPCMGPVPSLSLLPGRTRNPPKCRGRNPRPARNPASCRPASCSPKPRRLIAARGPASRCPRPGCAPSRAHPLPRAGRPAGTRAKGSPRPRSAPRPRCRPRGPSSLPDRKSTSRPRPPRRRGRRCQSRARRCCTSSTPRAATTATTPSSRITASTGRRRGHQGLAGLPC