McDonnell Genome Institute

Washington University

CircRNA

chr2|232703423|232796221|+|GIGYF2|ENST00000373563.8

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9819

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

7

Peptide

DPQGEIQALK

Amino Acids from 5' Exons

RKDLNKVCSNLLLTSRIFEQ,VKRITKSAQISCCEPAEFLN,LKGSEQSLLKSPAVNQQNFT

Amino Acids from 3' Exons

QAEKMVAYLQDSALDDERLASKLQEHRAKGVSIPLMHEAMQKWYYKDPQGEIQ,KLRKWWLISKTVHMMKDWHQNCKSTELKECRFHCMKQCRSGITKILREKFK,SENGGLSPRQCTRKIGIKTARAQSRSVDSIDASNAEVVLQRSSGRNS