McDonnell Genome Institute

Washington University

CircRNA

chr2|230864949|230873557|+|ITM2C|ENST00000457215.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9623

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

AGAAMVK

Amino Acids from 5' Exons

SSERRRQRPRLHRQRLRGGRAGRRSHGEDLPARRGWHQGRQGQGVGVGPCAGLGHRDPADAG,ARSGGGRDRGCTGRGCGADARAGAAMVKISFQPAVAGIKGDKADKASASAPAPASATEILLTPAR,LGAAEAETEAAPAEAAGRTRGPAQPWRLASSPPWLASRATRLTRRRRRPLRRPRPPRSCRRL

Amino Acids from 3' Exons

EEQPPQHRSKRGGSVGGVCYLSMGMVVLLMGLVFASVYIYRYFFLAQ,RSSPHNIDPRGGAQWAACATCRWAWSCCSWASCSPLSTSTDTSSLR,GAAPTTSIQEGGLSGRRVLPVDGHGRAAHGPRVRLCLHLQILLPCA