McDonnell Genome Institute

Washington University

CircRNA

chr2|229807707|229815194|-|TRIP12|ENST00000283943.9

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9217

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

IIEMNHACR

Amino Acids from 5' Exons

TYAMFTKRRHFCSYHVEEGKCTEHRWCDMAVASGPLASIQDQPDH,ELMPCLPKEGIFAVDTMLKKGNAQNTDGAIWQWRDDRGLWHPYNRIDSRIIE,NLCHVYQKKAFLQLIPCRREMHRTQMVRYGSGVMIGASGIHITGLTAGSL

Amino Acids from 3' Exons

MNHACRALTYMMEALPRSSAVVVDAIPVFLEK,TMLVEPHTWKHFLDLLLLMLFLSFK,EPCLSSLNIHDGSTSSIFCCCSRCYSCLFRK