McDonnell Genome Institute

Washington University

CircRNA

chr2|229803570|229808369|-|TRIP12|ENST00000283943.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9994

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

26

Peptide

EDIAETLHFLLCGASNGSCQEQIDLVPR

Amino Acids from 5' Exons

SHCFHAVKPRPEDSSGSTSDGRNFNAEVTYFCLLQKR,HIASMLSSQDLKIVVGALQMAEILMQKLPDIFSVYFRRE,TLLPCCQAKTRWEHFRWQKFCRSYLIFLVFTSEEK

Amino Acids from 3' Exons

TLQKRFTFSCVVPPMEVVRNRLILFHEALKSCMNHLF,HCRNASLSPVWCLQWKLSGTDSCSTKPSRVVTDISDL,IAETLHFLLCGASNGSCQEQIDLVPRSPQELYELTSLI