McDonnell Genome Institute

Washington University

CircRNA

chr2|227519947|227531210|+|AGFG1|ENST00000310078.12

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9338

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

18

Peptide

LQMQILQTLMHLDSLVVR

Amino Acids from 5' Exons

VCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKR,SVNRFGDYLMIDLQQFQTSGIHKKKSFYKKSMKRKD,LTDLARIIIFSNSRLQGSTKSERVSTRKVKEKM

Amino Acids from 3' Exons

LRILQMQILQTLMHLDSLVVRVILEVSPQQVTLLFSPKLQ,SEFCKCRFCKLCIWTVWFEFWRFPHSKSLSFSAPNY,QNSANADFANFDAFGQSSGSSNFGGFPTASHSPFQPQTT