McDonnell Genome Institute

Washington University

CircRNA

chr2|227088652|227098798|-|COL4A4|ENST00000396625.3

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9986

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

DLQGYQPTR

Amino Acids from 5' Exons

EMKDSVPVSLDPWAPLALQDFLGGRGVRETWGSLAGLEQKVTQDLLVLKDLQGY,KRTLCLAWTHGPPWPSRTSWEAGEGRLGAPWLAWNKRPRTSWCRTSRAT,NEGLCACEPGPMGPPGPPGLPGRQGSKGDLGLPGWLGTKGDPGPPGAEGPPGLP

Amino Acids from 3' Exons

AHQGTQGSLAAMEKQGMLDHLVPQVSWADQGKPVQ,PTRGPRVPWPLWRNRGCWTTWSPRSLGQTRGSLC,PPGDPGFPGRYGETGDVGPPGPPGLLGRPGEACA