McDonnell Genome Institute

Washington University

CircRNA

chr2|219251564|219252230|-|TUBA4A|ENST00000248437.8

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

39

Peptide

LRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDK

Amino Acids from 5' Exons

MRSEMAHTDSSSTQSSSSLGKRMLPTTMPVVTIPLARRSLTQCWIGSAS,DPKWPIPTALPPRAAHHWERGCCQQLCPWSLYHWQGDHPSAGSDPQA,EIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKL

Amino Acids from 3' Exons

RECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVI,VNASQSTWGRQVSRWAMPAGSSIAWNMGFSLMGRCPVTRPLVEGTTPSPPSSVKLVLENTYPGQFLWIWSLRSL,MHLSPRGAGRCPDGQCLLGALLLGTWDSAWADAQQDHWWRGRLLHHLLLNWCWKTRTPGSFCGSGAYGH