McDonnell Genome Institute

Washington University

CircRNA

chr2|219095273|219158362|-|NHEJ1|ENST00000418099.5

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9337

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

HIGLELYMLHR

Amino Acids from 5' Exons

LKDIPIKTGDPAYWPRTLHAASVSFYH,KIYPSKLETRHIGLELYMLHRSLFIM,KRYTHQNWRPGILANSTCCIGLFLS

Amino Acids from 3' Exons

MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAK,WKNWSKACCSHGRGYSLQRTPSWPRFLSPSRAMPCWFQIFNRCGMNRWTLVWSASEP,GRTGARPVDAAMGVATACRELPLGQGFYHQAGLCLVGFRSSTGVATGGHCGQPASQ