McDonnell Genome Institute

Washington University

CircRNA

chr2|218474629|218479715|-|USP37|ENST00000258399.7

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9975

26

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

TITELVLDH

Amino Acids from 5' Exons

DSKLCPIEPDKSELENSGFDRMSEEELLAAVLEISKRDASPSLSHEDDDKPTSSPDTGFAEDDIQEMPENPDTMETEKPKTITEL,IQNYAQSLTSLNWKTQDLTEAKKSFQLSWRVREMLHHLVMKMMISQLAAQIPDLQKMIFKKCQKIQTLWKLRSPKQSQSW,FKIMPNRAQVIGKLRIQNERRRASSSCLGDKERCFTISESRANQPRYRICRRYSRNARKSRHYGNEAQNNHRA

Amino Acids from 3' Exons

FTIESLSNGEFLHHQPFYTFK,SRPLKASQMVNSCITSPSTPS,LDHKPLKWIPASPALLHLQ