McDonnell Genome Institute

Washington University

CircRNA

chr2|218466009|218476981|-|USP37|ENST00000258399.7

Cancer

Type of Peptide

BRCA-Basal-like

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9939

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

LIGSSSMIWSVK

Amino Acids from 5' Exons

ILPVLLRLKTVMRIKKTKLQKDLREKLIGSSSMIWSVKGKSKSFSRHWLRAFKS,SCQFYDNRLERKQNSRRISGRSLAPAVYGAKGRARASAGTGSEPSRA,PASFTEITKDCDENKENKTPEGSQGEVDWLQQYDMEREREEQELQQALAQSLQEQ

Amino Acids from 3' Exons

EIHLQIQELLGFMPFRQGAKTFCGPQPETLNVRQRTAAGRPGK,KFTFKSKSSLALCLDSDSEDELKRSVALSQRLCEMLGNEQQQEDLEK,NSPSNPRAPWLYALIQTVRMSNVLWPSARDFVKCATNSSRKTWK