McDonnell Genome Institute

Washington University

CircRNA

chr2|216137087|216141319|+|XRCC5|ENST00000392132.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9989

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

23

6

Peptide

FQRLFQAAAVALSSLIHALDDLDMVAIVR

Amino Acids from 5' Exons

AAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYE,QLQLHFPPFMLWMTTWWPFDMLMTKELILKSAWLFLISSITM,SCSCTFLPDSCFGLRHGGHSSICLQKSSSSRRGFSSYQAL

Amino Acids from 3' Exons

RHSMLLMLLTPAWQRKMRRQTPLKTCFQPPKSQILDFRDYF,GTVECCCFDLHELGKEREDRHPRLVSNHQNPKSSISEIIS,AQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQ