McDonnell Genome Institute

Washington University

CircRNA

chr2|216122061|216126031|+|XRCC5|ENST00000392132.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9407

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

SLAFLTWQGR

Amino Acids from 5' Exons

LAFLTWQGRWKWGQRRWPLSLRWPWAFLSTKRNYRTAKRRSDSENGDDIFRRRWVGNLFIQ,LPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSF,CLSHLARKMEVGTEEMAPFAVAMGLPFHKELPNSKKKVLRKWYLKVKMGWMKFIHS

Amino Acids from 3' Exons

ESEKTVRLQENEAFHSLALPTDHWLQFVYKDCSLI,ESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKS,RVENCASSRKLRGIPFTGPADPLAPICLGLQPIN