McDonnell Genome Institute

Washington University

CircRNA

chr2|215391631|215410114|-|FN1|ENST00000323926.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9909

88

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

19

2

Peptide

NEEDVAELSISPSDNAVVLTK

Amino Acids from 5' Exons

LFLLPLTCDSPTLVQTPCVSPGLHPHPLIPTSWCVTHLKMRKMLQSCQFLLQTMQWSQ,CSSSHPAIHQHWSRHHACHLGSTPIHFNQLPGALLTCEKGRCCRVVNFSFRQCSGLN,VPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLT

Amino Acids from 3' Exons

KNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPVT,KILAVGRKLPYQATTPTPSKASLVWYTRASSSASSSTATKKLALTSPPPAPAHLP,KFCRPLEGSYHTRPLKLLHHQRPEAWCGIRGPAHQHPAVRPPRSDSLLHHHQHQHTCD