McDonnell Genome Institute

Washington University

CircRNA

chr2|215388211|215397848|-|FN1|ENST00000323926.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9978

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

13

Peptide

QLGVRPSQGGEAPR

Amino Acids from 5' Exons

ISCLVQNMVSPVSTNNMRAHLLEEDRKQ,SPAWYRICSECLQCLRTTEHTSRKTEN,LLPGTEYVVSVSSVYEQHESTPLRGRQKT

Amino Acids from 3' Exons

LGVRPSQGGEAPREVTSDSGSIVVSGLTPGVEYVYTIQVLRDGQERDAPIVNKVVT,WVYDQAREERHHEKLQTQEASLCPALQENTSTPSKSEMDRKEMRQLTKWH,GCTTKPGRRGTTRSDFRLRKHRCVRLDSRSRIRLHHPSPERWTGKRCANCKQSGD