McDonnell Genome Institute

Washington University

CircRNA

chr2|215379129|215410114|-|FN1|ENST00000323926.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9855

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

3

Peptide

EINLAPDSSSVVVSGLMK

Amino Acids from 5' Exons

LFLHQLTSSLRSHPQAAPSGHHPMFSSLDIECGPPRRRPDQKKSTLLLTAHPWLYQDL,YSCTNPEVHSGHTHKPERPVDTTQCSAHWISSAGDPQGEDRTNERNQPCSQLIRGCIRTY,IPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLM

Amino Acids from 3' Exons

KNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPVT,KILAVGRKLPYQATTPTPSKASLVWYTRASSSASSSTATKKLALTSPPPAPAHLP,KFCRPLEGSYHTRPLKLLHHQRPEAWCGIRGPAHQHPAVRPPRSDSLLHHHQHQHTCD