McDonnell Genome Institute

Washington University

CircRNA

chr2|215375213|215379317|-|FN1|ENST00000323926.10

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9737

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

17

8

Peptide

EVVPRPRPGVTEATITAIPAPTDLK

Amino Acids from 5' Exons

PLMHHPTCVSWPPHPIPCWYHGSRHVPGLPATSSSMRSLGLLPEKWSLGPALVSQRLLLL,HCTIQPAFPGHHTQFLAGIMAAATCQDYRLHHQVEAWVSSQRSGPSAPPWCHRGYYY,IDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATIT

Amino Acids from 3' Exons

LFLHQLTSSLRSHPQAAPSGHHPMFSSLDIECGPPRRRPDQKKSTLLLTAHPWLYQDL,YSCTNPEVHSGHTHKPERPVDTTQCSAHWISSAGDPQGEDRTNERNQPCSQLIRGCIRTY,IPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLM