McDonnell Genome Institute

Washington University

CircRNA

chr2|215373321|215376674|-|FN1|ENST00000323926.10

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9186

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

TDVSPPR

Amino Acids from 5' Exons

AWNREPNIQFMSLPRIIRRASPLEGKRQ,PGTGNRIYNLCHCPEESEERAPDWKEKD,LEPGTEYTIYVIALKNNQKSEPLIGRKKT

Amino Acids from 3' Exons

MSAHQEGLVQMLLRPPSPLAGEPRLRRSLASKLMPFQPMARLQSREPSSQMSEATPSQ,CQPTKKGSCDRCYDHHHHLENQDDDHWLPSCRSSQWPDSNPENHQARCQKLHHH,VSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTIT