McDonnell Genome Institute

Washington University

CircRNA

chr2|215011438|215018132|-|ABCA12|ENST00000272895.11

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9297

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

7

Peptide

YGIPINSSQLLEMFK

Amino Acids from 5' Exons

AMYRSNRMNTPQGSFSTISQALCSQGITTEYLTAMLPSSQRPKGNHTKDFLTYKLTKEQIASKYGIPINS,QCTEATETHHKDHLAPSPKHYVLKELPLNILPCCPLPRGQKATTPRIFLINLKSKLLQNMEFPIP,NVQKQPNEHTTRIIHHLPSIMFSRNYHIFNCHAALFPEAKRQPHQGFFDLINRANCFKIWNSHKF

Amino Acids from 3' Exons

VSYKCLKMLKSKKIGEQQECPTGLLTSCWPFPSLIIEL,SVTRNVKCRAERRFKENNRNVQQDYQVAGHSHPS,QLLEMFKNVEELKEDLRRTTGMSNRTIDKLLAIPIPDNRAE