McDonnell Genome Institute

Washington University

CircRNA

chr2|210658598|210677136|+|CPS1|ENST00000233072.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.999

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

15

Peptide

RTAVDSGIPLLTNFQVK

Amino Acids from 5' Exons

VKDATRKIAKAFAISGPFNVQFLVKGNDVL,RMLPGRLQRLLPSLVHSTSNFLSKEMMS,EGCYPEDCKGFCHLWSIQRPISCQRKCL

Amino Acids from 3' Exons

IDRWQHPSDPSQQQHICPLCDSEDSCWNPSPHFS,LIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQ,LEMAALTLTFPTTTLNLSMIIMFGGQLLIVESLSSLIF