McDonnell Genome Institute

Washington University

CircRNA

chr2|210582616|210642665|+|CPS1|ENST00000233072.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9505

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

8

Peptide

ILDIYHQEGTMLGK

Amino Acids from 5' Exons

GTMLGKIEFEGQPVDFVDPNKQNLIAEVSTK,VPCLGRLNLKVSLWILWIQINRILLRFQP,YHAWEDIRSACGFCGSKTEFDCGFNQ

Amino Acids from 3' Exons

AAVWNLIGVLSLVSAHCVNLARRRWWIAILRLAQTLMSVTNCTLKSCPWRESTSTIR,QQCGILVCCLYPHTASTWQEDGGGELQSDCEHRLVQTVLRVVLGENPRHLPSG,SSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDKLYFEELSLERILDIYHQE