McDonnell Genome Institute

Washington University

CircRNA

chr2|21033298|21042476|-|APOB|ENST00000233242.5

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9575

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

2

Peptide

GLSDEAVTSLLPQLIEVSRR

Amino Acids from 5' Exons

VLRRWASHLRAPNPHHLQSRPKLFRLSRNKNPSLSKISRELISSISWLLSEASVMKQSHLSCHSLRCP,YEDGPRIEHQIHITSKAGRSCFEDSPGTEKTNHLAKYPESSLQAGYAERPQSSHISLATADGVQ,TKKMGLAFESTKSTSPPKQAEAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSDEAVTSLLPQLIEVS

Amino Acids from 3' Exons

KMRPDSSTSGSTHTTMRLRVPVESLGLLIQEVPPGSTA,RCDPIQAPPEVHIQLGEFQWSPWDCFKKCHQDQLQ,DATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCK