McDonnell Genome Institute

Washington University

CircRNA

chr2|208001029|208001957|-|PLEKHM3|ENST00000427836.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9727

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

11

Peptide

IEDAQGNTGNQGLAWHCFDK

Amino Acids from 5' Exons

EIKDWRGIALTSTCCCLHRGLTEESQRNIWSPYTSVNAHPLANAFNYQENINHFGFGLLQGAQRFLPVVSIALLLKHPSWLGECSSHFWNQLRRLRPPGACDMEALEVDDISPALEVTEEFFSTLDSNLEKAVQQAEVYGIQEVPELVGHEVLSNITDNGAMRNVTSLGKGGMIWDHCKSRLLETKAQNVFPAKEQFMVQRGTTPDNLSWMEQKEASTFNFFNICQRRRDRPRSVNDLLDETSTFKPGHARSRSDITQVDWRVVLKTTPLQQQQQQQPLLQGPHVTRPSFLLPSPNKIEDAQGNT,KSRIGVALLQVLAVVFTEVSLKNNLKGTFGLPIHLLMPISHQMLLITRKTSTTLGLACSREPNEGFFQLFPLYCSTPLGWVNVHEAISGTSLGGGLLEPVTWKLWKWMISAQPKLRRNSLVLWIVIKRLCSRQRFMGSRKSLNWWGMRYSVTQTMVLEMSPPWARGAFGTTVRAGSKPKLKMSSLPKNSLWSREGQPQIIFPGWNKRKHQPLISSISVSVGGTGLVLMTYWMRPQLSSQGMLDHDQILPKWTGGSSKPRLCSSSNSSSHCFKARMSPGHLFCCPHQIRKMLKEIL,NQGLAWHCFDKYLLLSSQRSHRIISKEHLVSLYICCPLATSKCFLPGKHQPLWVWPAPGSPMKVSSSCFHSSIAEAPLLVGMFMKPFLEPAEAKASWSLHGSFGSGYQPSLRSYGGILYFGSRKGCAAGRGLWDPGSPTGGAGTQHNRQWCYEKCHLPGQGGHDLGPLEQALRNQSSKCLPCQRTVYGPERDNPRSFLDGTKGSINLFLQYLSASEGPASFCKLTGDLNFQARACSITIRYYPSGLEGSPQNHAFAAAATAAAIASRPACHQAIFSVALTKDRRCSRKY

Amino Acids from 3' Exons

EIKDWRGIALTSTCCCLHRGLTEESQRNIWSPYTSVNAHPLANAFNYQENINHFGFGLLQGAQRFLPVVSIALLLKHPSWLGECSSHFWNQLRRLRPPGACDMEALEVDDISPALEVTEEFFSTLDSNLEKAVQQAEVYGIQEVPELVGHEVLSNITDNGAMRNVTSLGKGGMIWDHCKSRLLETKAQNVFPAKEQFMVQRGTTPDNLSWMEQKEASTFNFFNICQRRRDRPRSVNDLLDETSTFKPGHARSRSDITQVDWRVVLKTTPLQQQQQQQPLLQGPHVTRPSFLLPSPNKIEDAQGNT,KSRIGVALLQVLAVVFTEVSLKNNLKGTFGLPIHLLMPISHQMLLITRKTSTTLGLACSREPNEGFFQLFPLYCSTPLGWVNVHEAISGTSLGGGLLEPVTWKLWKWMISAQPKLRRNSLVLWIVIKRLCSRQRFMGSRKSLNWWGMRYSVTQTMVLEMSPPWARGAFGTTVRAGSKPKLKMSSLPKNSLWSREGQPQIIFPGWNKRKHQPLISSISVSVGGTGLVLMTYWMRPQLSSQGMLDHDQILPKWTGGSSKPRLCSSSNSSSHCFKARMSPGHLFCCPHQIRKMLKEIL,NQGLAWHCFDKYLLLSSQRSHRIISKEHLVSLYICCPLATSKCFLPGKHQPLWVWPAPGSPMKVSSSCFHSSIAEAPLLVGMFMKPFLEPAEAKASWSLHGSFGSGYQPSLRSYGGILYFGSRKGCAAGRGLWDPGSPTGGAGTQHNRQWCYEKCHLPGQGGHDLGPLEQALRNQSSKCLPCQRTVYGPERDNPRSFLDGTKGSINLFLQYLSASEGPASFCKLTGDLNFQARACSITIRYYPSGLEGSPQNHAFAAAATAAAIASRPACHQAIFSVALTKDRRCSRKY