McDonnell Genome Institute

Washington University

CircRNA

chr2|207976650|207977586|-|PLEKHM3|ENST00000427836.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9985

32

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

10

Peptide

CAEHKQTFPNILK

Amino Acids from 5' Exons

NTSRHSQTFRRVTWRLERTMTVTGKAVMQNFHLTTYTSTASTAVGIKTFMPRTSFHTSRAYLFATWRPGWWILFCMTTLSYSRQSHHGRLWTGDRSFGKCMLLCPVTWGGRMSQSHQGLAIMMTIHRIIVSRRKPVGCCHRPLSWTAPNSTKTSSNQGLSTGLSKTTGRHLHLCAGLTLWLFSLASTRIHCATTWTCVWLSRWTTWMAATLAFKSFSPRMSFASELRPDRGLRNGWRLRLPMWRGVQSKTCKSHGTNPRIKWVGMNSGRTNANLLPASAFRLCLWNEDSLLRVSNVQ,TQADIPKHSKEGLPGDKGPQLLAKLLCRTFTLQLILLQPRQQWESKPLCHVPAFTLPEHICFRQPGGQDGGYCFVQHSATAKGRVTMGGFGLGTEALGSSACCCARLHGAAEADNLTRAWPSLYTESFPEENQWAAATVPCPGQLQTVPKHPQIRDSLQADCPKQLEGIYICAEQGLPYGFSAWQARRGSTVELQRGRVSGCPDGQPGWLRLLLSSHFPPGCPSPPSDPTEGSGMDGGSEDSCQCGEEFRAKPASHTEEQTQGSNGWATQEEQTPICDYQLPEHFDDFVFGTRTHCSEFQMC,HKQTFPNILKKGYLEIRKDHDSYWQSCYAELSPYNLYFYSLDSSGNQNLYATYQLSHFQSISVLGNLEARMVDTVLYDNTQLQLKAESPWEALDWGQKLWEVVHAAVPGYMGRQNELTISPGLGHHDDYTQNHSFQKKTSGLLPPSPVLDSSKQYQNILKSGTLYRLTVQNNWKAFTFVLSRAYLMAFQPGKLDEDPLLSYNVDVCLAVQMDNLDGCDSCFQVIFPQDVLRLRAETRQRAQEWMEALKIAANVARSSEQNLQVTLRNKPKDQMGGHELRKNKRQSVTTSFLSILTTLSLERGLTAQSFKCA

Amino Acids from 3' Exons

NTSRHSQTFRRVTWRLERTMTVTGKAVMQNFHLTTYTSTASTAVGIKTFMPRTSFHTSRAYLFATWRPGWWILFCMTTLSYSRQSHHGRLWTGDRSFGKCMLLCPVTWGGRMSQSHQGLAIMMTIHRIIVSRRKPVGCCHRPLSWTAPNSTKTSSNQGLSTGLSKTTGRHLHLCAGLTLWLFSLASTRIHCATTWTCVWLSRWTTWMAATLAFKSFSPRMSFASELRPDRGLRNGWRLRLPMWRGVQSKTCKSHGTNPRIKWVGMNSGRTNANLLPASAFRLCLWNEDSLLRVSNVQ,TQADIPKHSKEGLPGDKGPQLLAKLLCRTFTLQLILLQPRQQWESKPLCHVPAFTLPEHICFRQPGGQDGGYCFVQHSATAKGRVTMGGFGLGTEALGSSACCCARLHGAAEADNLTRAWPSLYTESFPEENQWAAATVPCPGQLQTVPKHPQIRDSLQADCPKQLEGIYICAEQGLPYGFSAWQARRGSTVELQRGRVSGCPDGQPGWLRLLLSSHFPPGCPSPPSDPTEGSGMDGGSEDSCQCGEEFRAKPASHTEEQTQGSNGWATQEEQTPICDYQLPEHFDDFVFGTRTHCSEFQMC,HKQTFPNILKKGYLEIRKDHDSYWQSCYAELSPYNLYFYSLDSSGNQNLYATYQLSHFQSISVLGNLEARMVDTVLYDNTQLQLKAESPWEALDWGQKLWEVVHAAVPGYMGRQNELTISPGLGHHDDYTQNHSFQKKTSGLLPPSPVLDSSKQYQNILKSGTLYRLTVQNNWKAFTFVLSRAYLMAFQPGKLDEDPLLSYNVDVCLAVQMDNLDGCDSCFQVIFPQDVLRLRAETRQRAQEWMEALKIAANVARSSEQNLQVTLRNKPKDQMGGHELRKNKRQSVTTSFLSILTTLSLERGLTAQSFKCA