McDonnell Genome Institute

Washington University

CircRNA

chr2|20290651|20312423|-|PUM2|ENST00000319801.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9532

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

11

Peptide

LAFGQGLATGMPDHSMSQPIMVQR

Amino Acids from 5' Exons

VLRAGAGQRPLTPNQGQQGQQAESLAAAAAANPTLAFGQGLATGMP,FSVLEQVSVLLLPIRVSKGSKQNHLRQLQQQIQHWLLVRVLLLACQ,SPCWSRSASSYSQSGSARAASRITCGSCSSKSNIGFWSGSCYWHA

Amino Acids from 3' Exons

TIQCPSLLWYREDLDRVFMETVKMQYCLRDQKVEALVAWNMYVLLLLINWILDLGREI,PFNVPAYYGTEKIWTGFSWKQSKCNTVSAIRKWRPWCEHGRICIKFFSCIGFSIEGKF,HSMSQPIMVQRRSGQGFHGNSEVNAILSPRSESGGLGVSMVEYVLSSSPADKLDSRFRKGNF