top of page

McDonnell Genome Institute

Washington University

CircRNA

chr2|202514887|202556531|+|BMPR2|ENST00000374580.8

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9669

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

22

Peptide

RAQRPNSLDLSATNVLDGSSIQR

Amino Acids from 5' Exons

ETVNKVFTVTWRQQHPNPLLIIINCW,RPTRSSQYEHDGGSSIRTLSSRSETVG,DRKQGLHSMNMMEAAASEPSLDLDNLKLLE

Amino Acids from 3' Exons

QPVTACAKNWSLSRLFFLLIHRLYPSYQHREEYFLAFYVQHTFDYRGKKPKFNLTTASTSSNPQPNKCHQPLHQHNNHKHHRTHAKYWHDYYIDAIPRNKSAYHKCCTVNWANPCLLTADRRRLGNQQARPKRSEPQGKLESHGALSTVQWPRPTEQYFLALPTHKTCSRSNWTAGLHTDCKWPSMFDSCSAYSDLSSPQAAEPSQETYFAFEHQKFNKRAPAKIWQQAQIKLETSRNWSCQDEYNQCSRTSCGDSHHEWCGRKPQCLPCCHNPICQWDSTIWPNNQHSDTGPRNVAESVYWGHPAEYFQSAAFTETRATSWPRCSGSSCGQEGTATRRWPNFQQQQQSMFRTRCSCTGCSKHSSRSWAIKAQKSTEAFSGSFSHKCPGWQQYT,NLSHNRRVPKIGPYPDYSSSSYIEDSIHHTDSIVKNISSEHSMSSTPLTIGEKNRNSINYERQQAQARIPSPETSVTSLSTNTTTTNTTGLTPSTGMTTISEMPYPDETNLHTTNVAQSIGPTPVCLQLTEEDLETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLSSTSSSLLYPLIKLAVEATGQQDFTQTANGQACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVTHRAQEMLQNQFIGEDTRLNINSSPDEHEPLLRREQQAGHDEGVLDRLVDRRERPLEGGRTNSNNNNSNPCSEQDVLAQGVPSTAADPGPSKPRRAQRPNSLDLSATNVLDGSSIQ,TCHIIGVCQKLVLIQIILPPHTLKTLSIILTASRIFPLSILCPAHLLGKKTEIQLTMNDSKHKLESPALKQVSPASPPTQQPQTPQDSRQVLALLYLRCHTQMKQICIPQMLHSQLGQPLSAYSQKKTWKPTSTQKKLIRTSRKALMRISWSTLLNSSVAQTHAVLVLACFTHSNLQKQLDSRTSHRLQMAKHVFLMFCLLRSILSPSSRTFPRDLLVCLTPKIQQKSPGNLAASTNQTNKSKLELPRIQSMQQNLMWQSPMVWQVETTVLTPMLPQPNMPMGQYYLAKQPTHIGPKKCCRISLLVRTPGILIPVLMSMSLYDESNKLAMMKVFWIVLWTGGNGHKVAELIPITTTAIHVQNKMFLHRVFQAQQQILGHQSPEEHRGLILWIFQPQMSWMAAVYR

bottom of page