McDonnell Genome Institute

Washington University

CircRNA

chr2|201192983|201209562|+|CASP10|ENST00000272879.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.993

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

4

Peptide

KLVPRPP

Amino Acids from 5' Exons

TSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPKLLRNIEKYKREK,PPVSWHFRNKVKMKIIHAWRTSAKQLYLNFETRNTKERK,LPKFPGISRETRNRRSDMPGGPLQNSCTTFEKHREIQKRE

Amino Acids from 3' Exons

RSVMCSSGLGSQCIYTIMRKWKWRWSCRSRSAIQPMPTGTASCSVFPMGDLELSTLRMRPSFPFGRSCLTSQPCSALDWLKNLNSFSSRPAKVKRYSLPYPSKQMLTLSRHPLPCRTVFLPRLTSYLVWPLSQAMYPFGMWRKAAGIFSLCVIIRNWSQ,DPESCVPVAWVHSAYTQCDESGNGDGPAEAEVQSSPCRRGLLRVLYSDPWEIWSCLLFGGPHSHSGDHVSLHSPAVPTGKTTLFHPGLPRRDTAFRIHRSRCSEPAGTHFPAGQYSCRGLPTWSGHCPRLCILSACGGRQLVYSVSVSSEEIGPK,ILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVP