McDonnell Genome Institute

Washington University

CircRNA

chr2|200439121|200470016|+|SPATS2L|ENST00000358677.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9331

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

8

Peptide

AQIMLCGEK

Amino Acids from 5' Exons

KATDYCNRNYPMGTPNLYMEQQRGQMAYSGQLSSLVTQASLRQKHLLLSPIPLQLILKSQMSWQRKE,RQQTTATETILRWEPQTYTWNNREVRWPTVVSAALPKQAGKNISCVQYPCSSSNKARVGKEK,GNRLLQQKLSLDGNPKPIHGTTERSDGLQWSAEQPCNPSKPKAKTSPVKSNTPAAHLEIKPDELAKKR

Amino Acids from 3' Exons

HFVSERKYDEELGKAARFSCDIEQLKAQIMLCGE,TLSASVNMTRSSGKLPGFPVTSNSRPKSCSAEK,LCQRAIRGARESCPVFLHRTAEGPNHALRR