McDonnell Genome Institute

Washington University

CircRNA

chr2|200416378|200419496|+|SPATS2L|ENST00000358677.9

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9877

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

GVTGSAIQVLK

Amino Acids from 5' Exons

AVQFKFKNGIQEKR,QCNSSSKRMEYDRKKE,SAIQVLKEWNMTGKKK

Amino Acids from 3' Exons

NNKRKRSKSKQHQGNKDAKDKVERPEAGPLQPQPPQIQNGPMNGCEKDSSSTDSANEKPALIPREKKISILEEPSKALRGVT,TIKEKEASPSSIKATKMLKTRWRGLRQGPCSRSHHRFKTAPMAARRTARPQILLTKNQPLSLVRKRSRYLRNLQRHFVGSQ,QKKKKQVQAASRQQRCRQGGEAGRAPAAAATTDSKRPHEWLREGQLVHRFCRKTSPYPSEKDLDTGTFKGTSWGH