McDonnell Genome Institute

Washington University

CircRNA

chr2|200329430|200419496|+|SPATS2L|ENST00000358677.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9044

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

GVTELFR

Amino Acids from 5' Exons

SSSETRLLSGTLLWIP,ALQKPGCFQEHCCGFP,LFRNQAAFRNIAVDSQ

Amino Acids from 3' Exons

NNKRKRSKSKQHQGNKDAKDKVERPEAGPLQPQPPQIQNGPMNGCEKDSSSTDSANEKPALIPREKKISILEEPSKALRGVT,TIKEKEASPSSIKATKMLKTRWRGLRQGPCSRSHHRFKTAPMAARRTARPQILLTKNQPLSLVRKRSRYLRNLQRHFVGSQ,QKKKKQVQAASRQQRCRQGGEAGRAPAAAATTDSKRPHEWLREGQLVHRFCRKTSPYPSEKDLDTGTFKGTSWGH