McDonnell Genome Institute

Washington University

CircRNA

chr2|20003160|20006310|-|MATN3|ENST00000407540.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9787

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

TCSGVCK

Amino Acids from 5' Exons

RWTPVCLEHTSASTSASVMGKASTTVSVAKDTPMPTRKRVQ,AGPLCAWNTPVPARLHQWGRQAPLVPRIHLECRQENVF,LDPCVLGTHQCQHVCISDGEGKHHCECSQGYTLNADKKTCS

Amino Acids from 3' Exons

VFARADPWTWCLSLIVLVAYGPWNSPKKLLSPGSTLWTLGQPTRGWQWTMLALRSSSNSRPTQISSPSRPWVESHPCQQAPCQAPSRQQWTKPSQWRQGLESPLLTSLRWPSLLQMGGPRTRMRWRLGPKHLVLSSMLWAWTGQTWRPSRWPVSPRSMFSTWRPMGSLRNFPLDSRKPSV,CLQEQTLGPGVYHFSRTAPGIHQSENFCLPDNRHSGHWASRHAGGSGELCHCEDRVPTPGLHRAVPEAGRGSNHTLVNRHHVRPSHPDSNGRSLHSGGRGSRALFHPGGHHCYRWEAPGPGEGGGSGPSIWYALCCGRGPGRHGVPQDDGQAPRGACFLRGDLWGHETFLIPGNLL,VCKSRPLDLVFIIDSSRSVRPLEFTKVKTFVSRIIDTLDIGPADTRVAVVNYASTVKIEFQLQAYTDKQSLKQAVGRITPLSTGTMSGLAIQTAMDEAFTVEAGAREPSSNIPKVAIIVTDGRPQDQVNEVAARAQASGIELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFC