McDonnell Genome Institute

Washington University

CircRNA

chr2|197407997|197408581|-|SF3B1|ENST00000335508.10

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9923

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

ILLGMEVDGLR

Amino Acids from 5' Exons

VTVLLNSFRLGGGKEKLMREIAHFLMRNMLCSQKDI,SHNEYDSTASGLAVGKRNEKSPTFGIRCYVPRRI,HIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYK

Amino Acids from 3' Exons

ILLGMEVDGLRLLEQIEVEILLVKHRLLEPVKENHGGMKHQLVRWVEALQFPLERHQLAHQPTWLPLLQ,YSWAWKWMGDSSNRSRWRFYWNTDSWSQKKITVGNTSSDGWKHSSSDPWKDTNWHTSHEHGYPYS,TPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAMNMATPTP