McDonnell Genome Institute

Washington University

CircRNA

chr2|197078702|197083509|-|ANKRD44|ENST00000282272.12

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9436

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

MMQIHLSGTRK

Amino Acids from 5' Exons

MSRVSASKCKSIYPGQGRLQHTLCCRLWAQAVSGI,CLEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLEL,VSFCFKMMQIHLSGTRKVTIAYIMLPPMGTGSVWN

Amino Acids from 3' Exons

DPFALCSCELSFPLYDISDHRGQRNRLGTHSFALRRCIRHGK,TPLHYAAANCHFHCIETLVTTGANVNETDDWGRTALHYAAASDMDR,PLCTMQLRIVISTVLRHPQGPTLMKQMTGDAQLCITPLHQTWIE