McDonnell Genome Institute

Washington University

CircRNA

chr2|196775115|196797908|-|GTF3C3|ENST00000263956.7

Cancer

Type of Peptide

BRCA-HER2-enriched

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9066

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

SQQIVMQK

Amino Acids from 5' Exons

VAMNRAQVCLISSSKSGERHLYLIKVSRDKISDSNDQESANCDAK,QIEPKFVYPVPSLERGIFILLKYRETKYQTAMTKSQQIVMQK,SNESSPSLFDIQFQVWREASLSYSIERQNIRQQPRVSKLCK

Amino Acids from 3' Exons

SLQEKGKLSAEENPDDSEVPSSSGINSTKSQDKDVNE,VFRKKASYQLKKIPMTLKFHHHQELTLPNPKTKMSMK,SSGKRQVISRKSRLSSIIIRNLYQIPRQRCQ