McDonnell Genome Institute

Washington University

CircRNA

chr2|188582340|188584403|+|GULP1|ENST00000433052.1

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

3

Peptide

LSLGLLIPPPSK

Amino Acids from 5' Exons

LLHNMSDHEQHVFQRCSSSFWRSNGDSSPCLNISSISVTPINSPDSRLSLGLLIPPPSKCGFPKPVSESSIPRPH,CCTICLIMNNMCFRDAHPLSGVVMVIHLPVSIFLPSLSLLSTRLIPDYHWDCYHHLLNVAFPSQSVRAASQDL,AAQYVSTTCVSEMLILFLAWFISLSQYFFHLCHSYQLAFQTITGTVNTTTFMWLSQASQEQHPKTS

Amino Acids from 3' Exons

AGSMTPKSPSTDIFDMIPFSPISHQSSMPTRNGTQPPPVPSRSTEI,QAVHLSRPPLTSLIFHFLQYHTSLRCLLAMAHSHLQYLVDLLRL,RQYDTVALHHLYDSIFSNITPVFDAYSQWHTATSSTIYD