McDonnell Genome Institute

Washington University

CircRNA

chr2|182956461|182962278|-|NCKAP1|ENST00000360982.2

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9875

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

2

Peptide

IFDFSSGNTLYQR

Amino Acids from 5' Exons

PIAHCTFVMLLYKLCTKHGGMGTYLYPTRIFDFSSGNTLYQ,LDKLHTALSELCFSINYVPNMVVWEHTFTPREYLTSHLEIRFT,LINCTLHFLSYASLIMYQTWWYGNIPLPHENILLIWKYALP

Amino Acids from 3' Exons

RHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQ,DIILEIAVFPYVICSMKWPNKLEISSLIFAQNSVPLVT,TSYWRSQSFLMYVPRNGQTSSKSHHYLHRTVYPP