McDonnell Genome Institute

Washington University

CircRNA

chr2|181458195|181522341|+|ITGA4|ENST00000397033.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9891

26

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

4

Peptide

ILELAPSGCAHCQLAR

Amino Acids from 5' Exons

APSGCAHCQLARQRFSDQSRGDLQMQDRKESRPDVRTAPA,LLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQL,SWVRPLPTGSPTLQSIPGRFTDAGSERIPARRANSSSW

Amino Acids from 3' Exons

APKNISCCWEYEDIDVECVLVCWRCINDSTCQTTRGSLFHDFRA,PHENKTYLAVGSMKTLMLNVSLFNAGDDAYETTLHVKLPVGLYFIKILEL,PMKIKHILLLGVRHCMCPCLMLEMMHMKRLYMSNYPWVFISLRFS