McDonnell Genome Institute

Washington University

CircRNA

chr2|179143591|179151391|-|SESTD1|ENST00000428443.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9857

115

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

8

Peptide

VMQVILVSANK

Amino Acids from 5' Exons

GMNCCPNYSSVDLMAQTEGFHGLLWMMNFLHSHRLNYIHSESNIPATRKFVGNVASAHSKRFNRRC,AIVVRITAASIWLRRRGFMVSYGTSCTATGYEIIRFTPRAIYPLPGSLATQAHTVRRDSTEGNA,HELLSELQQRRFNGSDGGVSWSPMDDELLAQPQVMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQKVMQ

Amino Acids from 3' Exons

VILVSANKLTRYIEPCQLTEDFGGSLTYDHMDWLNKRL,LFCPPTNLVINHANQKILVGVSPMITWTGIRG,YFSVRQQIDSLYRTMPINRRFWWESHLSHGLVKEA